CH
Tag Antibodies
Anti-Twin-Strep-tag Antibody (SAA0348)
All
  • CatalogTD-YP396033
  • ClonalitymAb
  • Application ELISA, WB
  • Synonyms
  • Specification
    50ug
  • Prices
    ¥询价
Customized service consulting

Anti-Twin-Strep-tag Antibody (SAA0348)


Catalog No. TD-YP396033
Species reactivity General
Applications ELISA, WB
Host species Mouse
Isotype IgG2b
Clone ID SAA0348
Clonality Monoclonal
Target Twin-Strep-tag, Twin Strep tag, TwinStrep tag,Streptag,Strep tag, SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK
Purification Protein A/G purified from cell culture supernatant.
Form Liquid
Storage buffer 0.01M PBS, pH 7.4.
Stability and Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Store at 4°C short term (1-2 weeks). Store at -20°C 12 months. Store at -80°C long term.
Note For research use only.